Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Yersinia pseudotuberculosis serotype IB Sulfoxide reductase heme-binding subunit YedZ (yedZ)

This Recombinant Yersinia pseudotuberculosis serotype IB Sulfoxide reductase heme-binding subunit YedZ (yedZ) spans the amino acid sequence from region 1-206.

Product Specifications

Product Name Alternative

Sulfoxide reductase heme-binding subunit YedZ, Flavocytochrome YedZ

UniProt

B2K460

Expression Region

1-206

Origin

Yersinia pseudotuberculosis serotype IB (strain PB1/+)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRLSLRHITWLKIAIWLAATLPLLWLVLSINLGGLSADPAKDIQHFTGRMALKLLLATLL VSPLARYSKQPLLLRCRRLLGLWCFAWGTLHLLSYSILELGLSNIGLLGHELINRPYLTL GIISWLVLLALALTSTRWAQRKMGARWQKLHNWVYVVAILAPIHYLWSVKTLSPWPIIYA VMAALLLLLRYKLLLPRYKKFRQWFR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mucin 5AC (MUC5AC) (45M1), CF740 conjugate, 0.1mg/mL
BNC740031-100 1x 100 µL

Mucin 5AC (MUC5AC) (45M1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF770 conjugate, 0.1mg/mL
BNC700160-500 1x 500 µL

CD20 (B9E9), CF770 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD16 (C16/1045), CF405S conjugate, 0.1mg/mL
BNC041045-500 1x 500 µL

CD16 (C16/1045), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD74 (BU45), CF488A conjugate, 0.1mg/mL
BNC880189-500 1x 500 µL

CD74 (BU45), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Von Willebrand Factor (3E2D10), CF740 conjugate, 0.1mg/mL
CD44 Standard (156-3C11), CF640R conjugate, 0.1mg/mL
BNC400460-100 1x 100 µL

CD44 Standard (156-3C11), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details