Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas fluorescens Sulfoxide reductase heme-binding subunit YedZ (yedZ)

This Recombinant Pseudomonas fluorescens Sulfoxide reductase heme-binding subunit YedZ (yedZ) spans the amino acid sequence from region 1-206.

Product Specifications

Product Name Alternative

Sulfoxide reductase heme-binding subunit YedZ, Flavocytochrome YedZ

UniProt

C3K222

Expression Region

1-206

Origin

Pseudomonas fluorescens (strain SBW25)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRYPIWRVGVFIAAAVWPLFWLYEAWSAVLGPDPGKVLVDRLGLGTLILLLITLAMTPLQ KLSGWAGWIAVRRQLGLWCFAYVVLHLAAYCVFVLGLDWSQLGVELRKRPYIIVGALGFL LLLVLAVTSNRYSQRRLGSRWKKLHRLVYVVLGLGLLHMLWIVRADLKEWAIYASIGALL LVLRIPPVMRRIPRLIAKKPLSATKA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD45 / LCA (2B11 + PD7/26), CF770 conjugate, 0.1mg/mL
BNC700745-100 1x 100 µL

CD45 / LCA (2B11 + PD7/26), CF770 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAGE A1 (MA454), CF568 conjugate, 0.1mg/mL
BNC680008-100 1x 100 µL

MAGE A1 (MA454), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD74 (BU45), CF740 conjugate, 0.1mg/mL
BNC740189-500 1x 500 µL

CD74 (BU45), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC18 / Mucin 18 / CD146 (OJ79c), CF488A conjugate, 0.1mg/mL
BNC880676-500 1x 500 µL

MUC18 / Mucin 18 / CD146 (OJ79c), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P21 / WAF1 (WA-1), CF647 conjugate, 0.1mg/mL
BNC470043-500 1x 500 µL

P21 / WAF1 (WA-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD5 (Cris-1), CF740 conjugate, 0.1mg/mL
BNC740176-500 1x 500 µL

CD5 (Cris-1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details