Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Paracoccus pantotrophus Putative dicarboxylate transporter subunit (dctM)

This Recombinant Paracoccus pantotrophus Putative dicarboxylate transporter subunit (dctM) spans the amino acid sequence from region 1-206.

Product Specifications

Product Name Alternative

Putative dicarboxylate transporter subunit

UniProt

Q56347

Expression Region

1-206

Origin

Paracoccus pantotrophus (Thiosphaera pantotropha)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

ALLLIVLIVGGIRGGVFTPTEASVVAVFYAIVTSAFVYRGFTLADLWGAFLRSAIMSVAV LMILAAARAFAWVLIIEGVPQMADAVIAMDLSPIAFLLMVNLLLLVFGMFMDPLPGVMIL VPILAPFATARIARDHFAIIVIVNLTFGLMTPPVGGLIFVVPRDPAEPSALIREQPPFFL AAMASLLILTFVPALSTWLPQISFAR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

BLNK (B Cell Linker Protein, B Cell Adapter Containing a SH2 Domain Protein, B Cell Adapter Containing a Src Homology 2 Domain Protein, Cytoplasmic Adapter Protein, Src Homology 2 Domain-containing Leukocyte Protein of 65kD, SLP-65, BASH, SLP65)
123947 100 µg

BLNK (B Cell Linker Protein, B Cell Adapter Containing a SH2 Domain Protein, B Cell Adapter Containing a Src Homology 2 Domain Protein, Cytoplasmic Adapter Protein, Src Homology 2 Domain-containing Leukocyte Protein of 65kD, SLP-65, BASH, SLP65)

Sign In for Pricing
View Details
Zfp2 sgRNA CRISPR Lentivector (Rat) (Target 3)
K6596904 1.0 µg DNA

Zfp2 sgRNA CRISPR Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
Recombinant Chicken Noggin (NOG), N-His
AP7F272-01 1 mg

Recombinant Chicken Noggin (NOG), N-His

Sign In for Pricing
View Details
Recombinant Chicken Noggin (NOG), N-His
AP7F272-02 10 µg

Recombinant Chicken Noggin (NOG), N-His

Sign In for Pricing
View Details
Recombinant Chicken Noggin (NOG), N-His
AP7F272-03 200 µg

Recombinant Chicken Noggin (NOG), N-His

Sign In for Pricing
View Details
Recombinant Chicken Noggin (NOG), N-His
AP7F272-04 5 mg

Recombinant Chicken Noggin (NOG), N-His

Sign In for Pricing
View Details