Recombinant Sulfoxide reductase heme-binding subunit YedZ (yedZ)
This Recombinant Sulfoxide reductase heme-binding subunit YedZ (yedZ) spans the amino acid sequence from region 1-206.
Product Specifications
Product Name Alternative
Sulfoxide reductase heme-binding subunit YedZ, Flavocytochrome YedZ
UniProt
Q665E9
Expression Region
1-206
Origin
Yersinia pseudotuberculosis
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MRLSLRHITWLKIAIWLAATLPLLWLVLSINLGGLSADPAKDIQHFTGRMALKLLLATLL VSPLARYSKQPLLLRCRRLLGLWCFAWGTLHLLSYSILELGLSNIGLLGHELINRPYLTL GIISWLVLLALALTSTRWAQRKMGARWQKLHNWVYVVAILAPIHYLWSVKTLSPWPIIYA VMAALLLLLRYKLLLPRYKKFRQWFR
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC040266-500 1x 500 µL
Human IgG Immunoglobulin (IG266), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC941223-500 1x 500 µL
Chromogranin A (LK2H10 + PHE5 + CGA414), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC051429-100 1x 100 µL
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF405M conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC942099-500 1x 500 µL
Catenin, beta (p120) (CTNNB1/2099), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC881920-500 1x 500 µL
CDX2 / Caudal Type Homeobox 2 (GI Epithelial Marker) (PCRP-CDX2-1A3), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details