Recombinant Sulfoxide reductase heme-binding subunit YedZ (yedZ)
This Recombinant Sulfoxide reductase heme-binding subunit YedZ (yedZ) spans the amino acid sequence from region 1-206.
Product Specifications
Product Name Alternative
Sulfoxide reductase heme-binding subunit YedZ, Flavocytochrome YedZ
UniProt
Q7W5H7
Expression Region
1-206
Origin
Bordetella parapertussis
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MPAAPLTARAIGRIKPLLFVAGLLPFARWFWLGANDGLSANPVEFLTRSSGTWTLVCLLV TLAITPLRRLTGQPALVRLRRMCGLFAFFYGSLHFLAWVWWDRGLDPVSMLQDVGERPFI TVGFAAFVLMAALAATSTQWAMRKLGKRWQVLHRAVYAIGLLAILHFWWHKAGKNDLQQP LLYGSVLALLLGWRVAAWWRRRGAAR
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC472137-500 1x 500 µL
OCT-2 (POU2F2) (B-Cell Marker) (OCT2/2137), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470280-100 1x 100 µL
Glycophorin A / CD235a (GYPA/280), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC402312-500 1x 500 µL
SOX10 (Melanoma Marker) (rSOX10/1074), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC401553-100 1x 100 µL
MUC6 (Mucin 6 / Gastric Mucin) (MUC6/1553R), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details