Recombinant Psychromonas ingrahamii Na (+) -translocating NADH-quinone reductase subunit D
This Recombinant Psychromonas ingrahamii Na (+) -translocating NADH-quinone reductase subunit D spans the amino acid sequence from region 1-210.
Product Specifications
Product Name Alternative
Na (+) -translocating NADH-quinone reductase subunit D, Na (+) -NQR subunit D, Na (+) -translocating NQR subunit D, EC= 1.6.5.-, NQR complex subunit D, NQR-1 subunit D
UniProt
A1SSY6
Expression Region
1-210
Origin
Psychromonas ingrahamii (strain 37)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MAKSNEIKAVLTSPIISNNPITLQILGICSALAVTSKLENAVVMTVAVLFVTAFSNFFIS TIRNYIPNSVRIIVQMAIIASLVIVVDQFLRAYAFSISKQLSVYVGLIITNCIVMGRAEA FAMKNKPIASFMDGVGNGLGYGVILILVGAFRELFGSGSLYGFVILPLTSNGGWYQSNGL LLLAPSAFFIVGGIIWAVRTMRPDQVEPKE
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC400679-100 1x 100 µL
CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880026-100 1x 100 µL
ACTH (Adrenocorticotrophic Hormone) (AH26), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC551037-500 1x 500 µL
CD44 Standard (DF1485), CF555 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880352-500 1x 500 µL
CD31 / PECAM-1 (158-2B3), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details