Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Enterobacter sp. Leucine efflux protein (leuE)

This Recombinant Enterobacter sp. Leucine efflux protein (leuE) spans the amino acid sequence from region 1-211.

Product Specifications

Product Name Alternative

Leucine efflux protein

UniProt

A4WB82

Expression Region

1-211

Origin

Enterobacter sp. (strain 638)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFAEFGVLNFWTYVVGAFFIVLVPGPNTLFVLKTGIGHGVKKGYLAATGVFIGDAVLMFL AWAGVAALIQTTPVLFNIVRYLGALYLLWLGGKMLWSVIMRKNSAHAGGAEPSSTILKRS LVLSLTNPKAILFYVSFFVQFIDVSATNTGTSFLILATTLELISFMYMSFLIFSGAFVTR YLKTKKKLAKLGNGLIGLLFVGFAARLASLH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rhodamine 101 Chloride Salt *CAS 64339-18-0*
75-AAT 25 mg

Rhodamine 101 Chloride Salt *CAS 64339-18-0*

Sign In for Pricing
View Details
Shaking Water Bath BBSW-103
BBSW-103 1 Unit

Shaking Water Bath BBSW-103

Sign In for Pricing
View Details
(+)-Nefopam Hydrochloride
TRC-N385745-50MG 50 mg

(+)-Nefopam Hydrochloride

Sign In for Pricing
View Details
Lithocholic Acid 24-Ac-O-beta-D-Glucuronide
TRC-L469195-1MG 1 mg

Lithocholic Acid 24-Ac-O-beta-D-Glucuronide

Sign In for Pricing
View Details
MCM7 (Proliferation Marker) (MCM7/1469), CF488A conjugate, 0.1mg/mL
BNC881469-500 1x 500 µL

MCM7 (Proliferation Marker) (MCM7/1469), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Colloidal Gold Conjugated Monoclonal Antibody to Herpes Simplex I,  40nm
GM-15-40 1 mL

Colloidal Gold Conjugated Monoclonal Antibody to Herpes Simplex I, 40nm

Sign In for Pricing
View Details