Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella enteritidis PT4 Arginine exporter protein ArgO (argO)

This Recombinant Salmonella enteritidis PT4 Arginine exporter protein ArgO (argO) spans the amino acid sequence from region 1-211.

Product Specifications

Product Name Alternative

Arginine exporter protein ArgO

UniProt

B5QXJ3

Expression Region

1-211

Origin

Salmonella enteritidis PT4 (strain P125109)

Field of Research

Infectious Disease & Virology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MISYYFQGFALGAAMILPLGPQNAFVMNQGIRRQYHLMIALLCALSDLVLISAGIFGGSA LLMQSPWLLALVTWGGVAFLLWYGLGALKTAMSSNLELASAEVMKQGRWKIIATMLAVTW LNPHVYLDTFVVLGSLGGQLAMEPKRWFALGTISASFLWFFGLALLAAWLAPRLRTAKAQ RIINILVGVVMWLIAFQLAREGVAHMHALFN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD10 (CB-CALLA), CF488A conjugate, 0.1mg/mL
BNC880146-500 1x 500 µL

CD10 (CB-CALLA), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD7 (T3-3A1), CF740 conjugate, 0.1mg/mL
BNC740978-100 1x 100 µL

CD7 (T3-3A1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
EGFRvIII (Epidermal Growth Factor Receptor, Variant III) (GFR/2600R), CF594 conjugate, 0.1mg/mL
BNC942600-500 1x 500 µL

EGFRvIII (Epidermal Growth Factor Receptor, Variant III) (GFR/2600R), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, Basic (Type II or HMW) (rKRTH/2148), CF740 conjugate, 0.1mg/mL
BNC742148-100 1x 100 µL

Cytokeratin, Basic (Type II or HMW) (rKRTH/2148), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ZAP70 (ZAP70/528 + 2F3.2), CF488A conjugate, 0.1mg/mL
BNC881137-500 1x 500 µL

ZAP70 (ZAP70/528 + 2F3.2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P21 / WAF1 (CIP1/823 + DCS-60.2), CF647 conjugate, 0.1mg/mL
BNC471135-500 1x 500 µL

P21 / WAF1 (CIP1/823 + DCS-60.2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details