Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Arginine exporter protein ArgO (argO)

This Recombinant Arginine exporter protein ArgO (argO) spans the amino acid sequence from region 1-211.

Product Specifications

Product Name Alternative

Arginine exporter protein ArgO

UniProt

Q8XD10

Expression Region

1-211

Origin

Escherichia coli O157:H7

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFSYYFQGLALGAAMILPLGPQNAFVMNQGIRRQYHIMIALLCAISDLVLICAGIFGGSA LLMQSPWLLALVTWGGVVFLLWYGFGAFKTAMSSNIELASAEVLKQGRWKIIATMLAVTW LNPHVYLDTFVVLGSLGGQLDVEPKRWFALGTISASFLWFFGLAILAAWLAPRLRTAKSQ RIINLVVGCVMWFIALQLARDGIAHAQALFS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nfam1 (NM_028728) Mouse Tagged ORF Clone Lentiviral Particle
MR220096L4V 200 µL

Nfam1 (NM_028728) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
TSPYL4 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)
48634061 1.0 µg DNA

TSPYL4 Lentiviral Vector (Human) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Vaccinia Related Kinase 1 (VRK1, Serine/threonine-protein kinase VRK1) (PE) discontinued
V0499-02-PE 200 µL

Vaccinia Related Kinase 1 (VRK1, Serine/threonine-protein kinase VRK1) (PE) discontinued

Sign In for Pricing
View Details
STIM1 Polyclonal Antibody
MBS8573376-01 0.1 mL

STIM1 Polyclonal Antibody

Sign In for Pricing
View Details
STIM1 Polyclonal Antibody
MBS8573376-02 0.1 mL (AF405L)

STIM1 Polyclonal Antibody

Sign In for Pricing
View Details
STIM1 Polyclonal Antibody
MBS8573376-03 0.1 mL (AF405S)

STIM1 Polyclonal Antibody

Sign In for Pricing
View Details