Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Leucine efflux protein (leuE)

This Recombinant Leucine efflux protein (leuE) spans the amino acid sequence from region 1-212.

Product Specifications

Product Name Alternative

Leucine efflux protein

UniProt

A1ABX2

Expression Region

1-212

Origin

Escherichia coli O1:K1 / APEC

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFAEYGVLNYWTYLVGAIFIVLVPGPNTLFVLKNSVSSGMKGGYLAACGVFIGDAVLMFL AWAGVATLIKTTPILFNIVRYLGAFYLLYLGSKILYATLKGKNSETKSDEPQYGAIFKRA LILSLTNPKAILFYVSFFVQFIDVNAPHTGISFFILATTLELVSFCYLSFLIISGAFVTQ YIRTKKKLAKVGNSLIGLMFVGFAARLATLQS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Psg26 Mouse Gene Knockout Kit (CRISPR)
KN514083 1 Kit

Psg26 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Tissue FFPE Sections, Tendon
CS800840 5x 5 µm

Tissue FFPE Sections, Tendon

Sign In for Pricing
View Details
Rat HSP-90 (Heat Shock Protein 90) CLIA Kit
E-CL-R0327-01 24 Tests

Rat HSP-90 (Heat Shock Protein 90) CLIA Kit

Sign In for Pricing
View Details
Rat HSP-90 (Heat Shock Protein 90) CLIA Kit
E-CL-R0327-02 48 Tests

Rat HSP-90 (Heat Shock Protein 90) CLIA Kit

Sign In for Pricing
View Details
Rat HSP-90 (Heat Shock Protein 90) CLIA Kit
E-CL-R0327-03 96 Tests

Rat HSP-90 (Heat Shock Protein 90) CLIA Kit

Sign In for Pricing
View Details
C12orf70 (SMCO2) Human Gene Knockout Kit (CRISPR)
KN427692 1 Kit

C12orf70 (SMCO2) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details