Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Citrobacter koseri Leucine efflux protein (leuE)

This Recombinant Citrobacter koseri Leucine efflux protein (leuE) spans the amino acid sequence from region 1-212.

Product Specifications

Product Name Alternative

Leucine efflux protein

UniProt

A8AHJ0

Expression Region

1-212

Origin

Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFAEYGVLNYWTYLVGAIFIVLVPGPNTIFVLKNSVGRGMKGGYLAASGVFIGDAVLMFL AYAGVATLIKTTPVLFNIVRYLGAFYLLYLGAKILYATLKSKGSEVAHDEVPFGAIFKRA LILSLTNPKAILFYVSFFVQFIDVNAPHAGLSFFILATTLEVVSFFYLSFLIISGAFVTQ YIRTKKKLAKVGNSLIGLIFVGFAARLATLQS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cathepsin O Protein, Human, Recombinant (E. coli, His & Myc)
TMPH-01062-01 5 µg

Cathepsin O Protein, Human, Recombinant (E. coli, His & Myc)

Sign In for Pricing
View Details
Cathepsin O Protein, Human, Recombinant (E. coli, His & Myc)
TMPH-01062-02 10 µg

Cathepsin O Protein, Human, Recombinant (E. coli, His & Myc)

Sign In for Pricing
View Details
Cathepsin O Protein, Human, Recombinant (E. coli, His & Myc)
TMPH-01062-03 20 µg

Cathepsin O Protein, Human, Recombinant (E. coli, His & Myc)

Sign In for Pricing
View Details
Cathepsin O Protein, Human, Recombinant (E. coli, His & Myc)
TMPH-01062-04 50 µg

Cathepsin O Protein, Human, Recombinant (E. coli, His & Myc)

Sign In for Pricing
View Details
Cathepsin O Protein, Human, Recombinant (E. coli, His & Myc)
TMPH-01062-05 100 µg

Cathepsin O Protein, Human, Recombinant (E. coli, His & Myc)

Sign In for Pricing
View Details
Cathepsin O Protein, Human, Recombinant (E. coli, His & Myc)
TMPH-01062-06 200 µg

Cathepsin O Protein, Human, Recombinant (E. coli, His & Myc)

Sign In for Pricing
View Details