What is the catalog number for Recombinant Leucine efflux protein (leuE)?

The catalog number for Recombinant Leucine efflux protein (leuE) is orb2912446.

What sizes are available for Recombinant Leucine efflux protein (leuE)?

Recombinant Leucine efflux protein (leuE) is available in the following size(s): 20 µg, 100 µg.

How many pack sizes does Recombinant Leucine efflux protein (leuE) come in?

Recombinant Leucine efflux protein (leuE) is available in 2 different pack sizes.

Is Recombinant Leucine efflux protein (leuE) in stock?

Recombinant Leucine efflux protein (leuE) is currently made to order / not held in immediate stock. Contact us for lead time.

Recombinant Leucine efflux protein (leuE)

This Recombinant Leucine efflux protein (leuE) spans the amino acid sequence from region 1-212.

Product Specifications

Product Name Alternative

Leucine efflux protein

UniProt

Q8XEV9

Expression Region

1-212

Origin

Salmonella typhi

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFAEYGVLNYWTYLVGAIFIVLVPGPNTLFVLKNSVGRGVKGGYLAACGVFIGDAILMFL AYAGVATLIKTTPVLFNIVRYLGAFYLLYLGAKILYATLTSKGRAATETVVPFGAIFKRA LILSLTNPKAILFYVSFFVQFIDVTAPHTGVSFFILATTLEIVSFCYLSFLILSGAFVTH YIGTKKKLAKVGNSLIGLLFVGFAARLATLQS