Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Putative amidate substrates transporter protein

This Recombinant Putative amidate substrates transporter protein spans the amino acid sequence from region 1-213.

Product Specifications

Product Name Alternative

Putative amidate substrates transporter protein

UniProt

P56583

Expression Region

1-213

Origin

Mycobacterium smegmatis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGGVGLFYVGAVLIIDGLMLLGRISPRGATPLNFFVGGLQVVTPTVLILQSGGDAAVIFA ASGLYLFGFTYLWVAINNVTDWDGEGLGWFSLFVAIAALGYSWHAFTAEADPAFGVIWLL WAVLWFMLFLLLGLGHDALGPAVGFVAVAEGVITAAVPAFLIVSGNWETGPLPAAVIAVI GFAAVVLAYPIGRRLAAPSVTNPPPAALAATTR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

H1FOO, ID (H1FOO, H1OO, OSH1, Histone H1oo, Oocyte-specific histone H1, Oocyte-specific linker histone H1) (Azide free) (HRP) discontinued
036397-HRP 200 µL

H1FOO, ID (H1FOO, H1OO, OSH1, Histone H1oo, Oocyte-specific histone H1, Oocyte-specific linker histone H1) (Azide free) (HRP) discontinued

Sign In for Pricing
View Details
RPL32 (60S Ribosomal Protein L32, PP9932) (HRP)
132787-HRP 100 µL

RPL32 (60S Ribosomal Protein L32, PP9932) (HRP)

Sign In for Pricing
View Details
NRBF2 Protein Vector (Mouse) (pPB-C-His)
PV206630 500 ng

NRBF2 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Lentiviral human SMIM13 shRNA (UAS) - Lentiviral human SMIM13 shRNA (UAS, GFP) (25)
GTR15092384 1 Vial

Lentiviral human SMIM13 shRNA (UAS) - Lentiviral human SMIM13 shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
FOXL2 Rabbit Monoclonal Antibody
orb3072740-01 30 µL

FOXL2 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
FOXL2 Rabbit Monoclonal Antibody
orb3072740-02 50 µL

FOXL2 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details