Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Glycerol-3-phosphate acyltransferase (plsY)

This Recombinant Glycerol-3-phosphate acyltransferase (plsY) spans the amino acid sequence from region 1-213.

Product Specifications

Product Name Alternative

Glycerol-3-phosphate acyltransferase, Acyl-PO4 G3P acyltransferase, Acyl-phosphate--glycerol-3-phosphate acyltransferase, G3P acyltransferase, GPAT, EC= 2.3.1.n3, Lysophosphati

UniProt

P0A4P9

Expression Region

1-213

Origin

Streptococcus pneumoniae

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MITIVLLILAYLLGSIPSGLWIGQVFFQINLREHGSGNTGTTNTFRILGKKAGMATFVID FFKGTLATLLPIIFHLQGVSPLIFGLLAVIGHTFPIFAGFKGGKAVATSAGVIFGFAPIF CLYLAIIFFGALYLGSMISLSSVTASIAAVIGVLLFPLFGFILSNYDSLFIAIILALASL IIIRHKDNIARIKNKTENLVPWGLNLTHQDPKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD7 (T3-3A1), CF488A conjugate, 0.1mg/mL
BNC880978-500 1x 500 µL

CD7 (T3-3A1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC3 (Mucin 3) (MUC3/2992R), CF740 conjugate, 0.1mg/mL
BNC742992-100 1x 100 µL

MUC3 (Mucin 3) (MUC3/2992R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Nucleolin (364-5 + NCL/902), CF740 conjugate, 0.1mg/mL
BNC741205-500 1x 500 µL

Nucleolin (364-5 + NCL/902), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TPO (Thyroid Peroxidase) (Thyroid Marker) (TPO/1922), CF488A conjugate, 0.1mg/mL
BNC881922-100 1x 100 µL

TPO (Thyroid Peroxidase) (Thyroid Marker) (TPO/1922), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD147 (BSG/963), CF640R conjugate, 0.1mg/mL
BNC400963-100 1x 100 µL

CD147 (BSG/963), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CELA3B / ELA3B (Pancreatic Function Marker) (CELA3B/1757), CF405S conjugate, 0.1mg/mL
BNC041757-100 1x 100 µL

CELA3B / ELA3B (Pancreatic Function Marker) (CELA3B/1757), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details