Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chlamydia trachomatis serovar L2b Na (+) -translocating NADH-quinone reductase subunit D

This Recombinant Chlamydia trachomatis serovar L2b Na (+) -translocating NADH-quinone reductase subunit D spans the amino acid sequence from region 1-213.

Product Specifications

Product Name Alternative

Na (+) -translocating NADH-quinone reductase subunit D, Na (+) -NQR subunit D, Na (+) -translocating NQR subunit D, EC= 1.6.5.-, NQR complex subunit D, NQR-1 subunit D

UniProt

B0BBR1

Expression Region

1-213

Origin

Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTTNKSYLTYFTDALWINNQPLIAILGICSALAVTTTVTTALTMGFAVSFVTGCSSFVVS LLRKITPESVRMIAQLIIISLFVILIDQFLKAFFFTISKTLSVFVGLIITNCIVMGRAES MARHVSPIPAFLDGLGSGLGYGWVLVCISIIRELFGFGTILGFRVIPEILYASAAHPDGY ENLGLMVLAPSAFFLLGIMIWIVNIIRAPKTKR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fibronectin (HFN7.1), CF647 conjugate, 0.1mg/mL
BNC470270-500 1x 500 µL

Fibronectin (HFN7.1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (MX-49.129.5), CF555 conjugate, 0.1mg/mL
BNC550525-100 1x 100 µL

CD63 (MX-49.129.5), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 5AC (MUC5AC) (45M1), CF640R conjugate, 0.1mg/mL
BNC400031-100 1x 100 µL

Mucin 5AC (MUC5AC) (45M1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD95 (B-R18), CF740 conjugate, 0.1mg/mL
BNC740305-500 1x 500 µL

CD95 (B-R18), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 15 (Esophageal Squamous Cell Carcinoma Marker) (KRT15/2103R), CF405S conjugate, 0.1mg/mL
BNC042103-500 1x 500 µL

Cytokeratin 15 (Esophageal Squamous Cell Carcinoma Marker) (KRT15/2103R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ZAP70 (ZAP70/528), CF640R conjugate, 0.1mg/mL
BNC400528-500 1x 500 µL

ZAP70 (ZAP70/528), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details