Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Buchnera aphidicola subsp. Baizongia pistaciae UPF0056 membrane protein bbp_248 (bbp_248)

This Recombinant Buchnera aphidicola subsp. Baizongia pistaciae UPF0056 membrane protein bbp_248 (bbp_248) spans the amino acid sequence from region 1-215.

Product Specifications

Product Name Alternative

UPF0056 membrane protein bbp_248

UniProt

Q89AL9

Expression Region

1-215

Origin

Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNVEMFDFSIYISFFFSLFALVNPIGMIPIFTSMTNHQSIVERNKTNLIANFSVAIILSI SLIFGSFILNLFGISINSFRISGGILVMIIAISMINGNFINNINNQKNGKLDKDIARNIS IVPLAMPLIAGPGAISSTIVWSTHYSSVENIFGCMVTIMLFSCFCWTLFKVSPIIVDILG RTGINIMTRIMGLLLMSLGIEFILAGLKASCSNYF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human IgG Immunoglobulin (IG266), CF488A conjugate, 0.1mg/mL
BNC880266-100 1x 100 µL

Human IgG Immunoglobulin (IG266), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAGE A1 (MA454), CF488A conjugate, 0.1mg/mL
BNC880008-500 1x 500 µL

MAGE A1 (MA454), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (DF1485), CF640R conjugate, 0.1mg/mL
BNC401037-500 1x 500 µL

CD44 Standard (DF1485), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD59 (heavy chain of Protectin) (BRA-10G), CF640R conjugate, 0.1mg/mL
BNC400181-500 1x 500 µL

CD59 (heavy chain of Protectin) (BRA-10G), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD79a (IGA/764), CF640R conjugate, 0.1mg/mL
BNC400764-100 1x 100 µL

CD79a (IGA/764), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Glucose Regulated Protein 94 (GRP94) (9G10.F8.2), CF405S conjugate, 0.1mg/mL
BNC040940-100 1x 100 µL

Glucose Regulated Protein 94 (GRP94) (9G10.F8.2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details