Recombinant Deinococcus radiodurans UPF0126 membrane protein DR_2368 (DR_2368)
This Recombinant Deinococcus radiodurans UPF0126 membrane protein DR_2368 (DR_2368) spans the amino acid sequence from region 1-215.
Product Specifications
Product Name Alternative
UPF0126 membrane protein DR_2368
UniProt
Q9RRW7
Expression Region
1-215
Origin
Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422)
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MNDTLLTTYTLAEGLHWLDLIGVLAFAMSGALLGVRKRFDLFGVLVLGAVTAVGGGAIRD SLTGQTPPLFLRDETYLWTALLGALLAFAFGERLARFERTLSLFDSAGLALFATSGALGA IKIGLGPLGVVFAGMLSGVGGGIIRDLIANEVPEVMYRRDQLYATAAAAGAGAVWLLAPH FTPFQAQAGGALLVLFLRWVSRRQWVRLPVRRLPE
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC400026-500 1x 500 µL
ACTH (Adrenocorticotrophic Hormone) (AH26), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740903-100 1x 100 µL
Cytokeratin 7 (KRT7/903), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC942313-500 1x 500 µL
Rb1 (Tumor Suppressor Protein) (RB1/2313R), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details