Recombinant Saccharomyces cerevisiae Putative uncharacterized transporter YOL162W (YOL162W)
This Recombinant Saccharomyces cerevisiae Putative uncharacterized transporter YOL162W (YOL162W) spans the amino acid sequence from region 1-215.
Product Specifications
Product Name Alternative
Putative uncharacterized transporter YOL162W
UniProt
P0CF19
Expression Region
1-215
Origin
Saccharomyces cerevisiae (strain ATCC 204508 / S288c) (Baker's yeast)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MGLLAYIPTNVLATYLTLVLRSIGFTTFQANLLAIPNFVLHILLLFGLTWSTEKCNNRLG LSLLQPLYTVPLLAVLRFWKGTMFNKWGTYAIITLILDNPYIHAICVSLCSRNSQSVKTR TVSTCLYNMFVQAGLIISSNIYAKSDAPLYRKGNGVLFGLALFMFPILIGSKLIYVYINK QRDKRWNAMSEEEKDHYLSTTSDAGSRRLDFRFYH
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC740965-500 1x 500 µL
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880679-500 1x 500 µL
CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC402216-500 1x 500 µL
CD50 / ICAM3 (CG106), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC401893-500 1x 500 µL
CD10 (Membrane Metalloendopeptidase) (MME/1893), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details