Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Streptococcus sanguinis Cobalt transport protein CbiM (cbiM)

This Recombinant Streptococcus sanguinis Cobalt transport protein CbiM (cbiM) spans the amino acid sequence from region 29-244.

Product Specifications

Product Name Alternative

Cobalt transport protein CbiM, Energy-coupling factor transporter probable substrate-capture protein CbiM, ECF transporter S component CbiM

UniProt

A3CL70

Expression Region

29-244

Origin

Streptococcus sanguinis (strain SK36)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHIMEGYLPLFWCIFWFAVFLPFFVVGLMRIKKIVAEDPNSKTMLALSGAFIFILSSLKI PSVTGSSSHPTGVGLGTAMFGPSVISVLGTICLLFQALLLAHGGLTTLGANAFSMAVVGP FVGYFVYKFAKSIKLSTPVSIFICAVIADLATYATTSIQLGLVFPDANSGFVGSALKFMG VFLTTQIPIAIVEGLLTVVLYNLISENVKERAGLFK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cyclophilin F (PPIF) Mouse Monoclonal Antibody [Clone ID: AT1F5]
AM09068PU-S 50 µL

Cyclophilin F (PPIF) Mouse Monoclonal Antibody [Clone ID: AT1F5]

Sign In for Pricing
View Details
Aflatoxin G1
TRC-A357480-5MG 5 mg

Aflatoxin G1

Sign In for Pricing
View Details
OR2W5 (C-term) Rabbit Polyclonal Antibody
AP53044PU-N 400 µL

OR2W5 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
20X Tris-Buffered Saline-Tween 20 (TBST) Buffer, Ultra Pure Grade, 1L
PB1650-1L 1 L

20X Tris-Buffered Saline-Tween 20 (TBST) Buffer, Ultra Pure Grade, 1L

Sign In for Pricing
View Details
Adamantoic Acid
TRC-A208200-25G 25 g

Adamantoic Acid

Sign In for Pricing
View Details
BD5 Human
OM297018-01 20 µg

BD5 Human

Sign In for Pricing
View Details