Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pseudomonas aeruginosa Uncharacterized membrane protein PA4757 (PA4757)

This Recombinant Pseudomonas aeruginosa Uncharacterized membrane protein PA4757 (PA4757) spans the amino acid sequence from region 1-216.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein PA4757

UniProt

P38102

Expression Region

1-216

Origin

Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MPTLGITDFWTYVLGVVFVILLPGPNSLFVLATSAQRGVATGYRAACGVFLGDAVLMLLS ALGVASLLKAEPMLFIGLKYLGAAYLFYLGVGMLRGAWRKLRNPEATAAQAEQVDVHQPF RKALLLSLSNPKAILFFISFFIQFVDPGYAYPGLSFLVLAVILELVSALYLSFLIFTGVR LAAWFRRRQRLAAGATSGVGALFVGFGVKLATATLS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TGF-beta (1D11.16.8), CF770 conjugate, 0.1mg/mL
BNC700977-100 1x 100 µL

TGF-beta (1D11.16.8), CF770 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD20 (B9E9), CF568 conjugate, 0.1mg/mL
BNC680160-100 1x 100 µL

CD20 (B9E9), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAGE A1 (MA454), CF640R conjugate, 0.1mg/mL
BNC400008-100 1x 100 µL

MAGE A1 (MA454), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC2 (CCP58), CF488A conjugate, 0.1mg/mL
BNC880032-500 1x 500 µL

MUC2 (CCP58), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP27 (G3.1), CF594 conjugate, 0.1mg/mL
BNC940861-500 1x 500 µL

HSP27 (G3.1), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8/18 (C-51), CF405S conjugate, 0.1mg/mL
BNC040034-100 1x 100 µL

Cytokeratin 8/18 (C-51), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details