Recombinant Clostridium sticklandii Cobalt transport protein CbiM (cbiM)
This Recombinant Clostridium sticklandii Cobalt transport protein CbiM (cbiM) spans the amino acid sequence from region 25-241.
Product Specifications
Product Name Alternative
Cobalt transport protein CbiM, Energy-coupling factor transporter probable substrate-capture protein CbiM, ECF transporter S component CbiM
UniProt
E3PSD4
Expression Region
25-241
Origin
Clostridium sticklandii (strain ATCC 12662 / DSM 519 / JCM 1433 / NCIB 10654)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MHIMEGFLPPLWAAIWSVISLPFIVGGFSKIKKITDESPNMKLLLGLVGAFVFVLSALKL PSVTGSTSHPTGVGLGTIIFGPLPMAVIGLIVLIFQALLLAHGGITTLGANVFSMAIVGP FAGYFIFKAIKDKNRSLAVFLAAMLADLITYIVTSLQLALAHPDAVNGIVGSFTKFMGIF AITQIPLAIGEGILTLIVYNLLVEYQKEGGFNLEKTH
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC040043-500 1x 500 µL
P21 / WAF1 (WA-1), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880149-100 1x 100 µL
CD106 / VCAM1 (1.4C3), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC432615-500 1x 500 µL
Cadherin 17 / LI Cadherin (Liver-Intestine Marker) (CDH17/2615), CF543 conjugate, 0.1mg/mL
Sign In for Pricing
View Details