Recombinant Archaeoglobus fulgidus Putative cobalt transport protein CbiM (cbiM)
This Recombinant Archaeoglobus fulgidus Putative cobalt transport protein CbiM (cbiM) spans the amino acid sequence from region 1-217.
Product Specifications
Product Name Alternative
Putative cobalt transport protein CbiM, Energy-coupling factor transporter probable substrate-capture protein CbiM, ECF transporter S component CbiM
UniProt
O29530
Expression Region
1-217
Origin
Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MHIMEGYLPPEWAAFWYVFAIPFLVYGALRVKRIIEEKPSMKSLIAVSAGFIFVLSALKL PSVTGSCSHPTGTGIAVVFFGPAVTALLSAIVLLYQALLLAHGGITTLGANTASMGVIGP FVGWIAFKLLKNVNFRVAVFAAAMLSDLVTYVVTSLQLALAFPSSAGVAGIIKSAATFMG IFAVTQVPLSIIEGVVAVMLVSYIFEVRSDVLEVVKA
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC680525-500 1x 500 µL
CD63 (MX-49.129.5), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880266-100 1x 100 µL
Human IgG Immunoglobulin (IG266), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC740304-500 1x 500 µL
CD106 / VCAM1 (B-K9), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC941790-100 1x 100 µL
CD79a (B-Cell Marker) (IGA/1790R), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details