Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Enterococcus faecalis Glycerol-3-phosphate acyltransferase (plsY)

This Recombinant Enterococcus faecalis Glycerol-3-phosphate acyltransferase (plsY) spans the amino acid sequence from region 1-217.

Product Specifications

Product Name Alternative

Glycerol-3-phosphate acyltransferase, Acyl-PO4 G3P acyltransferase, Acyl-phosphate--glycerol-3-phosphate acyltransferase, G3P acyltransferase, GPAT, EC= 2.3.1.n3, Lysophosphati

UniProt

Q834K7

Expression Region

1-217

Origin

Enterococcus faecalis (strain ATCC 700802 / V583)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKIVILLLVAYLLGSIPSGVWIGKLFFKKDIRQFGSGNTGTTNTFRVLGKPAGITVLLMD ILKGTLATSLPYLFGLQGVNPLFFGVAAVLGHTFPIFANFKGGKAVATSAGMLLAYSPTF FIYSALIFVICLYLTSMVSLTSMISAVLITLSTIILPFTVPAILPTFNWLLTVIAIALTT FIFVRHRENIQRIKNGTESRLSFGLRAKKIKKKAVNK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SS18L1 Protein Vector (Human) (pPM-C-His)
PV040180 500 ng

SS18L1 Protein Vector (Human) (pPM-C-His)

Sign In for Pricing
View Details
Factor XIII B Polypeptide antibody
MBS5301416-01 0.1 mL

Factor XIII B Polypeptide antibody

Sign In for Pricing
View Details
Factor XIII B Polypeptide antibody
MBS5301416-02 5x 0.1 mL

Factor XIII B Polypeptide antibody

Sign In for Pricing
View Details
Gm17296 Protein Vector (Mouse) (pPM-C-His)
PV183589 500 ng

Gm17296 Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Weinbersterol disulfate A
orb1738547-01 25 mg

Weinbersterol disulfate A

Sign In for Pricing
View Details
Weinbersterol disulfate A
orb1738547-02 50 mg

Weinbersterol disulfate A

Sign In for Pricing
View Details