Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Enterococcus faecalis Glycerol-3-phosphate acyltransferase (plsY)

This Recombinant Enterococcus faecalis Glycerol-3-phosphate acyltransferase (plsY) spans the amino acid sequence from region 1-217.

Product Specifications

Product Name Alternative

Glycerol-3-phosphate acyltransferase, Acyl-PO4 G3P acyltransferase, Acyl-phosphate--glycerol-3-phosphate acyltransferase, G3P acyltransferase, GPAT, EC= 2.3.1.n3, Lysophosphati

UniProt

Q834K7

Expression Region

1-217

Origin

Enterococcus faecalis (strain ATCC 700802 / V583)

Field of Research

Pharmacology & Drug Discovery

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MKIVILLLVAYLLGSIPSGVWIGKLFFKKDIRQFGSGNTGTTNTFRVLGKPAGITVLLMD ILKGTLATSLPYLFGLQGVNPLFFGVAAVLGHTFPIFANFKGGKAVATSAGMLLAYSPTF FIYSALIFVICLYLTSMVSLTSMISAVLITLSTIILPFTVPAILPTFNWLLTVIAIALTT FIFVRHRENIQRIKNGTESRLSFGLRAKKIKKKAVNK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PPP1R2P9 3'UTR Luciferase Stable Cell Line
TU018635 1.0 mL

PPP1R2P9 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
PE anti-human TCR Vα24-Jα18 (iNKT cell)
FC0800 100 Tests

PE anti-human TCR Vα24-Jα18 (iNKT cell)

Sign In for Pricing
View Details
OR51T1 CRISPR/Cas9 KO Plasmid (h)
sc-415987 20 µg

OR51T1 CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details
NCF1 Protein Vector (Human) (pPB-N-His)
PV027766 500 ng

NCF1 Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details
GLP2R siRNA (Rat)
MBS8214544-01 15 nmol

GLP2R siRNA (Rat)

Sign In for Pricing
View Details
GLP2R siRNA (Rat)
MBS8214544-02 30 nmol

GLP2R siRNA (Rat)

Sign In for Pricing
View Details