Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rhodobacter capsulatus Heme exporter protein B (helB)

This Recombinant Rhodobacter capsulatus Heme exporter protein B (helB) spans the amino acid sequence from region 1-218.

Product Specifications

Product Name Alternative

Heme exporter protein B, Cytochrome c-type biogenesis protein HelB

UniProt

P29960

Expression Region

1-218

Origin

Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003)

Field of Research

Epigenetics & Chromatin

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MRALLSRDLRLAIRAGGGFGLGLAFFLIVVTLVPFGVGPQGEILARIASGILWLGALLAC LLSLDRIFALDFEDGSLDLLATAPIPMEAVVTIKALAHWITTGLPLVLAAPLFAVLLHLP APAYLWLEVSLLLGTPALSVLGTFGAALTVGLKRGGLLLPLLALPLYVPTLIFGAELVRR GAEGLAIEVPLAMLAGITAATVALVPFASAAAIRVNLR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD50 / ICAM3 (CG106), CF405S conjugate, 0.1mg/mL
BNC042216-500 1x 500 µL

CD50 / ICAM3 (CG106), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD74 (BU45), CF647 conjugate, 0.1mg/mL
BNC470189-500 1x 500 µL

CD74 (BU45), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD71 (66IG10), CF594 conjugate, 0.1mg/mL
BNC940871-100 1x 100 µL

CD71 (66IG10), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tyrosinase (T311), CF568 conjugate, 0.1mg/mL
BNC680012-500 1x 500 µL

Tyrosinase (T311), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tyrosinase (T311), CF568 conjugate, 0.1mg/mL
BNC680012-100 1x 100 µL

Tyrosinase (T311), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD28 (204.12), CF405S conjugate, 0.1mg/mL
BNC040164-100 1x 100 µL

CD28 (204.12), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details