Recombinant Brucella ovis Probable intracellular septation protein A (BOV_1862)
This Recombinant Brucella ovis Probable intracellular septation protein A (BOV_1862) spans the amino acid sequence from region 1-220.
Product Specifications
Product Name Alternative
Probable intracellular septation protein A
UniProt
A5VSR0
Expression Region
1-220
Origin
Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MEHPVFERDPSEKSETERREVPPLLKLALELGPLLVFFFANARGEMLIERFPILGSIGAP IFLATALFMAATVIALAISWSMTRTLPIMPLVSGIVVLVFGALTLWLHNDTFIKMKPTIV NTLFGGILLGGLFFGKSLLGYVFDSAFRLDAEGWRKLTLRWGLFFIFLAIVNEIVWRNFS TDTWVSFKVWGIMPITIVFTLLQMPLIQKHSLTDEENTAS
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC740679-500 1x 500 µL
CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC682216-500 1x 500 µL
CD50 / ICAM3 (CG106), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC682643-500 1x 500 µL
Prolactin (Pituitary Tumor Marker) (PRL/2643), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC681897-100 1x 100 µL
Caldesmon, HMW (h-Caldesmon) (Smooth Muscle Marker) (rCALD1/820), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details