Recombinant Ochrobactrum anthropi Sulfoxide reductase heme-binding subunit YedZ (yedZ)
This Recombinant Ochrobactrum anthropi Sulfoxide reductase heme-binding subunit YedZ (yedZ) spans the amino acid sequence from region 1-220.
Product Specifications
Product Name Alternative
Sulfoxide reductase heme-binding subunit YedZ, Flavocytochrome YedZ
UniProt
A6WYN0
Expression Region
1-220
Origin
Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MAAAAQTGKKKTVRPGEWKIWLLYAVGFVPAVWTFYLGASGNLGADPVKTFEHTLGLWAL RFLILTLMVTPIRDLTGMAFLRYRRALGLLAFYYALMHFATYMVLDQGLNISAIVTDIVR RPFITIGMISLVLLVPLALTSNNWSIRKLGRRWNSLHKLVYVAIAGGAIHFIMSVKSWPA EPVIYAGIVSALLLWRLVRPHARNRKPVSRPRGEAMAVKK
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC470679-100 1x 100 µL
CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC882216-100 1x 100 µL
CD50 / ICAM3 (CG106), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680781-100 1x 100 µL
Carbonic Anhydrase IX (CA9/781), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC941892-100 1x 100 µL
CD10 (Membrane Metalloendopeptidase) (MME/1892), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details