Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Brucella canis Sulfoxide reductase heme-binding subunit YedZ (yedZ)

This Recombinant Brucella canis Sulfoxide reductase heme-binding subunit YedZ (yedZ) spans the amino acid sequence from region 1-220.

Product Specifications

Product Name Alternative

Sulfoxide reductase heme-binding subunit YedZ, Flavocytochrome YedZ

UniProt

A9MCR7

Expression Region

1-220

Origin

Brucella canis (strain ATCC 23365 / NCTC 10854)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAAATGTRKKKTPRPGQWKLWLLYTAGFVPAVWTFYLGATGQLGADPVKTFEHLLGLWAL RFLILTLLVTPIRDLTGITLLRYRRALGLLAFYYALMHFTTYMVLDQGLNLSAIITDIVR RPFITIGMISLALLVPLALTSNNWSIRKLGRRWSSLHKLVYIAIAGSAVHFLMSVKSWPA EPVIYAAIVAALLLWRLARPYLRTRKPALRPRGEAIALRK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD45RO (190-2F2.5), CF594 conjugate, 0.1mg/mL
BNC941081-500 1x 500 µL

CD45RO (190-2F2.5), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Complement C4d (C4D204), CF405S conjugate, 0.1mg/mL
BNC040204-100 1x 100 µL

Complement C4d (C4D204), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAGE A1 (MA454), CF405S conjugate, 0.1mg/mL
BNC040008-100 1x 100 µL

MAGE A1 (MA454), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (RIV11), CF568 conjugate, 0.1mg/mL
BNC680333-500 1x 500 µL

CD8 (RIV11), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tyrosinase-Related Protein-1 (TYRP-1) (Melanoma Marker) (TYRP1/2340R), CF647 conjugate, 0.1mg/mL
BNC472340-500 1x 500 µL

Tyrosinase-Related Protein-1 (TYRP-1) (Melanoma Marker) (TYRP1/2340R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MiTF (Microphthalmia Transcription Factor) (C5/D5), CF488A conjugate, 0.1mg/mL
BNC880892-500 1x 500 µL

MiTF (Microphthalmia Transcription Factor) (C5/D5), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details