Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Brucella melitensis biotype 2 Probable intracellular septation protein A (BMEA_A1992)

This Recombinant Brucella melitensis biotype 2 Probable intracellular septation protein A (BMEA_A1992) spans the amino acid sequence from region 1-220.

Product Specifications

Product Name Alternative

Probable intracellular septation protein A

UniProt

C0RFI0

Expression Region

1-220

Origin

Brucella melitensis biotype 2 (strain ATCC 23457)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEHPVFKRDPSEKSETERREVPPLLKLALELGPLLVFFFANARGEMLIERFPILGSIGAP IFLATALFMAATVIALAISWSMTRTLPIMPLVSGIVVLVFGALTLWLHNDTFIKMKPTIV NTLFGGILLGGLFFGKSLLGYVFDSAFRLDAEGWRKLTLRWALFFIFLAIVNEIVWRNFS TDTWVSFKVWGIMPITIVFTLLQMPLIQKHSLTDEENTAS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCZ1B (Vacuolar Fusion Protein CCZ1 Homolog B)
477450 100 µL

CCZ1B (Vacuolar Fusion Protein CCZ1 Homolog B)

Sign In for Pricing
View Details
PSME3 (NM_176863) Human Tagged Lenti ORF Clone
RC222312L2 10 µg

PSME3 (NM_176863) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
SLC39A7 polyclonal antibody
orb1088628-01 50 μL

SLC39A7 polyclonal antibody

Sign In for Pricing
View Details
SLC39A7 polyclonal antibody
orb1088628-02 100 µL

SLC39A7 polyclonal antibody

Sign In for Pricing
View Details
SLC39A7 polyclonal antibody
orb1088628-03 200 µL

SLC39A7 polyclonal antibody

Sign In for Pricing
View Details
FLCN Rabbit Polyclonal Antibody
E10G08341 100 µL

FLCN Rabbit Polyclonal Antibody

Sign In for Pricing
View Details