Recombinant Methanocaldococcus jannaschii Probable ATPase proteolipid chain (MJ0221)
This Recombinant Methanocaldococcus jannaschii Probable ATPase proteolipid chain (MJ0221) spans the amino acid sequence from region 1-220.
Product Specifications
Product Name Alternative
Probable ATPase proteolipid chain
UniProt
Q57674
Expression Region
1-220
Origin
Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MVDPLILGAVGAGLAVGIAGLGSGIGAGITGASGAGVVAEDPNKFGTAIVFQALPQTQGL YGFLVAILILFVFKTVSPWAMFAAGLAAGLAGLSAIGQGIAASAGLGAVAEDNSIFGKAM VFSVLPETQAIYGLLIAILLLVGVFKGNAGAETVAALGAGFAVGFAGLSGIGQGITAAGA IGATARDPDAMGKGLVLAVMPETFAIFGLLIAILIMLMIK
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC470806-500 1x 500 µL
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC040745-100 1x 100 µL
CD45 / LCA (2B11 + PD7/26), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC471003-100 1x 100 µL
Mucin 5AC (MUC5AC) (58M1), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC400043-500 1x 500 µL
P21 / WAF1 (WA-1), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details