Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Heme exporter protein B (ccmB)

This Recombinant Heme exporter protein B (ccmB) spans the amino acid sequence from region 1-220.

Product Specifications

Product Name Alternative

Heme exporter protein B, Cytochrome c-type biogenesis protein CcmB

UniProt

Q83QV3

Expression Region

1-220

Origin

Shigella flexneri

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMFWRIFRLELRVAFRHSAEIANPLWFFLIVITLFPLSIGPEPQLLARIAPGIIWVAALL SSLLALERLFRDDLQDGSLEQLMLLPLPLPAVVLAKVMAHWMVTGLPLLILSPLVAMLLG MDVYGWQVMALTLLLGTPTLGFLGAPGVALTVGLKRGGVLLSILVLPLTIPLLIFATAAM DAASMHLPVEGYLAILGALLAGTATLSPFATAAALRISIQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human TUBA6 (TUBA1C) activation kit by CRISPRa
GA113693 1 Kit

Human TUBA6 (TUBA1C) activation kit by CRISPRa

Sign In for Pricing
View Details
ATG4A Recombinant Rabbit Monoclonal Antibody [JE32-31]
HA721010 100 µL

ATG4A Recombinant Rabbit Monoclonal Antibody [JE32-31]

Sign In for Pricing
View Details
Tissue FFPE Sections, Adrenal gland
CS806188 5x 5 µm

Tissue FFPE Sections, Adrenal gland

Sign In for Pricing
View Details
1-Butan-1,1-d2-ol
TRC-B690046-10MG 10 mg

1-Butan-1,1-d2-ol

Sign In for Pricing
View Details
Angiopoietin 1 (ANGPT1) Mouse Monoclonal Antibody [Clone ID: OTI8C5]
CF807191 100 µg

Angiopoietin 1 (ANGPT1) Mouse Monoclonal Antibody [Clone ID: OTI8C5]

Sign In for Pricing
View Details
3,6-Bis(4-chlorophenyl)pyrrolo[3,4-c]pyrrole-1,4(2H,5H)-dione (Technical Grade)
TRC-C375433-50MG 50 mg

3,6-Bis(4-chlorophenyl)pyrrolo[3,4-c]pyrrole-1,4(2H,5H)-dione (Technical Grade)

Sign In for Pricing
View Details