Recombinant Brucella melitensis biotype 1 Sulfoxide reductase heme-binding subunit YedZ (yedZ)
This Recombinant Brucella melitensis biotype 1 Sulfoxide reductase heme-binding subunit YedZ (yedZ) spans the amino acid sequence from region 1-220.
Product Specifications
Product Name Alternative
Sulfoxide reductase heme-binding subunit YedZ, Flavocytochrome YedZ
UniProt
Q8YD73
Expression Region
1-220
Origin
Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MAAATGTRKKKTPRPGQWKLWLLYTAGFVPAVWTFYLGATGQLGADPVKTFEHLLGLWAL RFLILTLLVTPMRDLTGITLLRYRRALGLLAFYYALMHFTTYMVLDQGLNLSAIITDIVR RPFITIGMISLALLVPLALTSNNWSIRKLGRRWSSLHKLVYIAIAGSAVHFLMSVKSWPA EPVIYAAIVAALLLWRLARPYLRTRKPALRPRGEAIALRK
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC471824-100 1x 100 µL
Ksp-Cadherin (Kidney-Specific Cadherin) / CDH16 (rCDH16/1071), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880773-500 1x 500 µL
CD20 (IGEL/773), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470841-100 1x 100 µL
Pgp9.5 (UCHL-1) (UCHL1/841), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC742156-100 1x 100 µL
Catenin, gamma (Cardiomyocyte Marker) (rCTNG/1664), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details