Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Latimeria chalumnae ATP synthase subunit a (MT-ATP6)

This Recombinant Latimeria chalumnae ATP synthase subunit a (MT-ATP6) spans the amino acid sequence from region 1-220.

Product Specifications

Product Name Alternative

ATP synthase subunit a, F-ATPase protein 6

UniProt

O03169

Expression Region

1-220

Origin

Latimeria chalumnae (West Indian ocean coelacanth)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSLNFFDQFMSPTLLGVPLIAVAMMFPWTLLPTPTNRWLNNRTLTLQNWFIGRFTNQLLQ PLNTGGHKWAMILMSLNLLGLLPYTFTPTTQLSLNMGLAIPFWLATVLLGLRNQPTAALG HLLPEGTPTLLIPILIIIETISLLIRPFALGVRLTANLTAGHLLMQLIATAAFVLLPMMP TVALLTTLVLFLLTLLEIAVAMIQAYVFVLLLSLYLQENV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Von Willebrand Factor (3E2D10), CF594 conjugate, 0.1mg/mL
CD100 (Semaphorin-4D) (A8), CF405S conjugate, 0.1mg/mL
BNC040218-100 1x 100 µL

CD100 (Semaphorin-4D) (A8), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD86 (BU63), CF488A conjugate, 0.1mg/mL
BNC880193-500 1x 500 µL

CD86 (BU63), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (MX-49.129.5), CF740 conjugate, 0.1mg/mL
BNC740525-100 1x 100 µL

CD63 (MX-49.129.5), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TOX3 (TOX3/1124), CF647 conjugate, 0.1mg/mL
BNC471124-500 1x 500 µL

TOX3 (TOX3/1124), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD1a (O10), CF405S conjugate, 0.1mg/mL
BNC040667-100 1x 100 µL

CD1a (O10), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details