Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant UPF0056 inner membrane protein marC (marC)

This Recombinant UPF0056 inner membrane protein marC (marC) spans the amino acid sequence from region 1-221.

Product Specifications

Product Name Alternative

UPF0056 inner membrane protein marC

UniProt

A1ABA8

Expression Region

1-221

Origin

Escherichia coli O1:K1 / APEC

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLDLFKAIGLGLVVLLPLANPLTTVALFLGLAGNMSSAERNRQSLMASVYVFAIMMVAYY AGQLVMDTFGISIPGLRIAGGLIVAFIGFRMLFPQQKAIDSPEAKSKSEELEDEPSANIA FVPLAMPSTAGPGTIAMIISSASTVRQSSTFADWVLMVAPPLIFFLVAVILWGSLRSSGA IMRLVGKGGIEAISRLMGFLLVCMGVQFIINGILEIIKTYH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

XEDAR (Tumor Necrosis Factor Receptor Superfamily Member 27, X-linked Ectodysplasin A2 Receptor, EDA-A2 Receptor, TNFRSF27, EDA-A2R, EDA2R, EDAA2R) (MaxLight 550)
135439-ML550 100 µL

XEDAR (Tumor Necrosis Factor Receptor Superfamily Member 27, X-linked Ectodysplasin A2 Receptor, EDA-A2 Receptor, TNFRSF27, EDA-A2R, EDA2R, EDAA2R) (MaxLight 550)

Sign In for Pricing
View Details
Tetraspanin 5 (TSPAN5) Peptide
abx616927 100 µg

Tetraspanin 5 (TSPAN5) Peptide

Sign In for Pricing
View Details
Methyl 2,2-dithienylglycolate
282400-01 50 g

Methyl 2,2-dithienylglycolate

Sign In for Pricing
View Details
Methyl 2,2-dithienylglycolate
282400-02 100 g

Methyl 2,2-dithienylglycolate

Sign In for Pricing
View Details
Methyl 2,2-dithienylglycolate
282400-03 250 g

Methyl 2,2-dithienylglycolate

Sign In for Pricing
View Details
Methyl 2,2-dithienylglycolate
282400-04 500 g

Methyl 2,2-dithienylglycolate

Sign In for Pricing
View Details