Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Salmonella paratyphi B UPF0056 inner membrane protein marC (marC)

This Recombinant Salmonella paratyphi B UPF0056 inner membrane protein marC (marC) spans the amino acid sequence from region 1-221.

Product Specifications

Product Name Alternative

UPF0056 inner membrane protein marC

UniProt

A9MYZ8

Expression Region

1-221

Origin

Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7)

Field of Research

Infectious Disease & Virology; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMDLFKAIGLGLVVLLPLANPLTTVALFLGLAGNMNSAERNRQSYMASVYVFAIMMVAYY AGQLVMNTFGISIPGLRIAGGLIVAFIGFRMLFPQQKAHESPEAKSKSEELADEPTANIA FVPLAMPSTAGPGTIAMIISSASTVRHGGEFPDWVIMVAPPIIFLAVAVILWGCLRSSGA IMRLVGKGGIEAISRLMGFLLVCMGVQFIINGVLEIIKTYH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD28 (204.12), CF660R conjugate, 0.1mg/mL
BNC610164-100 1x 100 µL

CD28 (204.12), CF660R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP60 (LK1), CF740 conjugate, 0.1mg/mL
BNC740851-500 1x 500 µL

HSP60 (LK1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (C8/1035), CF488A conjugate, 0.1mg/mL
BNC881035-500 1x 500 µL

CD8 (C8/1035), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
EGFR (31G7), CF594 conjugate, 0.1mg/mL
BNC941194-500 1x 500 µL

EGFR (31G7), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TTF-1 / NKX2.1 (NX2.1/690), CF568 conjugate, 0.1mg/mL
BNC680690-100 1x 100 µL

TTF-1 / NKX2.1 (NX2.1/690), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Thyroglobulin (2H11 + 6E1), CF568 conjugate, 0.1mg/mL
BNC680724-500 1x 500 µL

Thyroglobulin (2H11 + 6E1), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details