Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Aquifex aeolicus Uncharacterized protein aq_1078 (aq_1078)

This Recombinant Aquifex aeolicus Uncharacterized protein aq_1078 (aq_1078) spans the amino acid sequence from region 1-221.

Product Specifications

Product Name Alternative

Uncharacterized protein aq_1078

UniProt

O67171

Expression Region

1-221

Origin

Aquifex aeolicus (strain VF5)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MYLENCIVILTSTTPPWWAIPPAWSLGAEIQAYFLLPILLTYKMLGLSVFWISYIIYSLA NLNIIHSDYFGYRLIPGVIFMFLSGAYLQKIVSGKASRLEMLSLIIIYIISLFWLVFFII IKGKYGAYTRETLLGLLVGIPLVYTLLKIRRKFYFNDLFGKLSYGIFLSHFLSFWILEFV NLTQNIISMIFLSLIISASVSYLIITLIENKVEKIRYNLTR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD10 (CB-CALLA), CF594 conjugate, 0.1mg/mL
BNC940146-500 1x 500 µL

CD10 (CB-CALLA), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Von Willebrand Factor (3E2D10), CF555 conjugate, 0.1mg/mL
BNC550633-100 1x 100 µL

Von Willebrand Factor (3E2D10), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD53 (161-2), CF405S conjugate, 0.1mg/mL
BNC040324-100 1x 100 µL

CD53 (161-2), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (C8/1035), CF640R conjugate, 0.1mg/mL
BNC401035-100 1x 100 µL

CD8 (C8/1035), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Thyroglobulin (TGB04 + TGB05), CF640R conjugate, 0.1mg/mL
BNC401227-500 1x 500 µL

Thyroglobulin (TGB04 + TGB05), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (C8/1035), Biotin conjugate, 0.1mg/mL
BNCB1035-500 1x 500 µL

CD8 (C8/1035), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details