Recombinant Escherichia coli UPF0056 inner membrane protein marC (marC)
This Recombinant Escherichia coli UPF0056 inner membrane protein marC (marC) spans the amino acid sequence from region 1-221.
Product Specifications
Product Name Alternative
UPF0056 inner membrane protein marC
UniProt
B1IRT1
Expression Region
1-221
Origin
Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks)
Field of Research
Infectious Disease & Virology; Cell Biology
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MLDLFKAIGLGLVVLLPLANPLTTVALFLGLAGNMNSAERNRQSLMASVYVFAIMMVAYY AGQLVMDTFGISIPGLRIAGGLIVAFIGFRMLFPQQKAIDSPEAKSKSEELEDEPSAHIA FVPLAMPSTAGPGTIAMIISSASTVRQSSTFADWVLMVAPPLIFFLVAVILWGSLRSSGA IMRLVGKGGIEAISRLMGFLLVCMGVQFIINGILEIIKTYH
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC940012-500 1x 500 µL
Tyrosinase (T311), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC041970-500 1x 500 µL
Thyroglobulin (Thyroidal Cell Marker) (TGB/1970R), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC042340-100 1x 100 µL
Tyrosinase-Related Protein-1 (TYRP-1) (Melanoma Marker) (TYRP1/2340R), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC470907-100 1x 100 µL
TTF-1 / NKX2.1 (8G7G3/1 + NX2.1/690), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 