Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Escherichia coli UPF0056 inner membrane protein marC (marC)

This Recombinant Escherichia coli UPF0056 inner membrane protein marC (marC) spans the amino acid sequence from region 1-221.

Product Specifications

Product Name Alternative

UPF0056 inner membrane protein marC

UniProt

B1LF84

Expression Region

1-221

Origin

Escherichia coli (strain SMS-3-5 / SECEC)

Field of Research

Infectious Disease & Virology; Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLDLFKAIGLGLVVLLPLANPLTTVALFLGLAGNMNSAERNRQSLMASVYVFAIMMVAYY AGQLVMDTFGISIPGLRIAGGLIVAFIGFRMLFPQQKAIDSPEAKSKSKELEDEPSANIA FVPLAMPSTAGPGTIAMIISSASTVRQSSTFADWVLMVAPPLIFFLVAVILWGSLRSSGA IMRLVGKGGIEAISRLMGFLLVCMGVQFIINGILEIIKTYH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD63 (MX-49.129.5), CF488A conjugate, 0.1mg/mL
BNC880525-500 1x 500 µL

CD63 (MX-49.129.5), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human IgG Immunoglobulin (IG266), CF594 conjugate, 0.1mg/mL
BNC940266-100 1x 100 µL

Human IgG Immunoglobulin (IG266), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (VU-1D9), CF488A conjugate, 0.1mg/mL
BNC880017-100 1x 100 µL

Ep-CAM / CD326 (VU-1D9), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, HMW (AE-3), CF568 conjugate, 0.1mg/mL
BNC680257-500 1x 500 µL

Cytokeratin, HMW (AE-3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TGF-beta (1D11.16.8), CF568 conjugate, 0.1mg/mL
BNC680977-100 1x 100 µL

TGF-beta (1D11.16.8), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Neurofilament (NF-L) (NFL/736), CF647 conjugate, 0.1mg/mL
BNC470736-500 1x 500 µL

Neurofilament (NF-L) (NFL/736), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details