Recombinant Oryza sativa subsp. japonica 3-hydroxyacyl-CoA dehydratase PASTICCINO 2B (PAS2B)
This Recombinant Oryza sativa subsp. japonica 3-hydroxyacyl-CoA dehydratase PASTICCINO 2B (PAS2B) spans the amino acid sequence from region 1-221.
Product Specifications
Product Name Alternative
3-hydroxyacyl-CoA dehydratase PASTICCINO 2B, HACD, PAS2B, EC= 4.2.1.-, Protein tyrosine phosphatase-like protein
UniProt
Q5ZEJ0
Expression Region
1-221
Origin
Oryza sativa subsp. japonica (Rice)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MTGVGSAVRRLYLSVYNWAVFFGWAQVLYYAVTTLLESGHEAVYAAVERPLQFAQTAAFL EILHGLVGLVRSPVSATLPQIGSRLFLTWGILWSFPETHSHILVTSLVISWSITEIIRYS FFGMKETFGFAPSWLLWLRYSTFMVLYPTGISSEVGLIYIALPYMKATEKYCLRMPNKWN FSFDFSYASILSLAVYVPGSPHMFTYMLAQRKKALAKAKAA
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC471037-100 1x 100 µL
CD44 Standard (DF1485), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC550017-100 1x 100 µL
Ep-CAM / CD326 (VU-1D9), CF555 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940266-100 1x 100 µL
Human IgG Immunoglobulin (IG266), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC402174-500 1x 500 µL
Cytokeratin 8 (KRT8) (KRT8/2174R), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details