Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 8C (Tmem8c)

This Recombinant Mouse Transmembrane protein 8C (Tmem8c) spans the amino acid sequence from region 1-221.

Product Specifications

Product Name Alternative

Transmembrane protein 8C

UniProt

Q9D1N4

Expression Region

1-221

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGTVVAKLLLPTLSSLAFLPTVSIATKRRFYMEAMVYLFTMFFVAFSHACDGPGLSVLCF MRRDILEYFSIYGTALSMWVSLMALADFDEPQRSTFTMLGVLTIAVRTFHDRWGYGVYSG PIGTATLIIAVKWLKKMKEKKGLYPDKSIYTQQIGPGLCFGALALMLRFFFEEWDYTYVH SFYHCALAMSFVLLLPKVNKKAGNAGAPAKLTFSTLCCTCV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Magic™ Membrane Protein Human CD300C (CD300c molecule) Full Length
MPC2534K Each

Magic™ Membrane Protein Human CD300C (CD300c molecule) Full Length

Sign In for Pricing
View Details
Rabbit Polyclonal FAIM1 Antibody
NBP2-47463 0.1 mL

Rabbit Polyclonal FAIM1 Antibody

Sign In for Pricing
View Details
Rabbit Anti NR1H3 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 1% BSA and 50% glycerol, pH7.4) (IHC) 120ul
IRBAMLNR1H3AP218120UL 120 µL

Rabbit Anti NR1H3 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 1% BSA and 50% glycerol, pH7.4) (IHC) 120ul

Sign In for Pricing
View Details
Stfa1 3'UTR Lenti-reporter-Luc Vector
45717084 1.0 µg

Stfa1 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
3CD16b/Fcgr3b , C-terminal Avi-His-tag, in vivo biotinylated
REC32071-100 1 Each

3CD16b/Fcgr3b , C-terminal Avi-His-tag, in vivo biotinylated

Sign In for Pricing
View Details
Phospho-Tau (Ser 199) Rabbit mAb
F2614-100uL*2 2x 100 μL

Phospho-Tau (Ser 199) Rabbit mAb

Sign In for Pricing
View Details