Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rhipicephalus sanguineus ATP synthase subunit a (ATP6)

This Recombinant Rhipicephalus sanguineus ATP synthase subunit a (ATP6) spans the amino acid sequence from region 1-221.

Product Specifications

Product Name Alternative

ATP synthase subunit a, F-ATPase protein 6

UniProt

O99821

Expression Region

1-221

Origin

Rhipicephalus sanguineus (Brown dog tick) (Ixodes sanguineus)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMNNLFSVFDPSTSSNFNLNWLSLFILMTIAPFSFWASSSLFLISWKSLLKKFFQEISNN IKLSKMKNCLIISSIFIFILLSNVMGLLPYVFTSSSHLVFTMFLAFPFWMTFILFSLINK FNMVMAHLVPMGSPMALSFFMVIIETVSNIIRPITLSVRLTANMISGHLLIHLLSSISMF SNLLFMVSIPFMMILLILETAVAFIQGFVFVILISLYINES

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD86 (BU63), CF594 conjugate, 0.1mg/mL
BNC940193-500 1x 500 µL

CD86 (BU63), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD71 (66IG10), CF405S conjugate, 0.1mg/mL
BNC040871-500 1x 500 µL

CD71 (66IG10), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD35 / CR1 (E11), CF568 conjugate, 0.1mg/mL
BNC680040-500 1x 500 µL

CD35 / CR1 (E11), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD100 (Semaphorin-4D) (A8), CF647 conjugate, 0.1mg/mL
BNC470218-100 1x 100 µL

CD100 (Semaphorin-4D) (A8), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP60 (LK1), CF647 conjugate, 0.1mg/mL
BNC470851-100 1x 100 µL

HSP60 (LK1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, pan (Epithelial Marker) (KRTH/1576R + KRTL/1577R), CF568 conjugate, 0.1mg/mL
BNC681600-500 1x 500 µL

Cytokeratin, pan (Epithelial Marker) (KRTH/1576R + KRTL/1577R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details