Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Roseiflexus sp. Cobalt transport protein CbiM (cbiM)

This Recombinant Roseiflexus sp. Cobalt transport protein CbiM (cbiM) spans the amino acid sequence from region 28-249.

Product Specifications

Product Name Alternative

Cobalt transport protein CbiM, Energy-coupling factor transporter probable substrate-capture protein CbiM, ECF transporter S component CbiM

UniProt

A5UQS9

Expression Region

28-249

Origin

Roseiflexus sp. (strain RS-1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHIMEGFLPPVWAGFWFIVVLPFWVLGLRRINRLIAGKPETRLLLGFAAAFAFVLSALKI PSVTGSSSHPTGTGLGTILFGPLVMSVLGSIVLLFQALLIAHGGLTTLGANAFSMAVVGP FVAWLIWKGLKDRAPIWLTVFLAAALADLFTYVVTSAQLALAYPDAVGGFAASFARFGAI FAVTQIPLAISEGILTVLIFNALQANAQTELQSLGVLKGAQA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TGF-beta (1D11.16.8), CF568 conjugate, 0.1mg/mL
BNC680977-100 1x 100 µL

TGF-beta (1D11.16.8), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD104 (UM-A9), CF647 conjugate, 0.1mg/mL
BNC470449-100 1x 100 µL

CD104 (UM-A9), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD53 (161-2), CF488A conjugate, 0.1mg/mL
BNC880324-100 1x 100 µL

CD53 (161-2), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (C8/1035), CF405S conjugate, 0.1mg/mL
BNC041035-100 1x 100 µL

CD8 (C8/1035), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (RIV11), CF640R conjugate, 0.1mg/mL
BNC400333-100 1x 100 µL

CD8 (RIV11), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (Membrane Metalloendopeptidase) (MME/2579), CF488A conjugate, 0.1mg/mL
BNC882579-100 1x 100 µL

CD10 (Membrane Metalloendopeptidase) (MME/2579), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details