Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mammuthus primigenius ATP synthase subunit a (MT-ATP6)

This Recombinant Mammuthus primigenius ATP synthase subunit a (MT-ATP6) spans the amino acid sequence from region 1-222.

Product Specifications

Product Name Alternative

ATP synthase subunit a, F-ATPase protein 6

UniProt

Q38PR7

Expression Region

1-222

Origin

Mammuthus primigenius (Siberian woolly mammoth)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNEELSAFFDVPVGTMMLAIAFPAILLPTPNRLITNRWITIQQWLVKLIMKQLLSIHNTK GLSWSLMLITLTLFIGLTNLLGLLPYSFAPTAQLTVNLSMAIPLWTGTVILGFRYKTKIS LAHLLPQGTPTFLIPMIIIIETISLLIRPVTLAVRLTANITAGHLLIHLTGTAALTLLSI HSMTITVTFITVVVLTILELAVALIQAYVFALLISLYLHESA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD13 / Aminopeptidase-N (Myeloid Cell Marker) (APN/1464), CF740 conjugate, 0.1mg/mL
BNC741464-100 1x 100 µL

CD13 / Aminopeptidase-N (Myeloid Cell Marker) (APN/1464), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
ALS2CR13 (FAM117B) (NM_173511) Human Over-expression Lysate
LY432314 100 µg

ALS2CR13 (FAM117B) (NM_173511) Human Over-expression Lysate

Sign In for Pricing
View Details
PLOD1 (NM_000302) Human Over-expression Lysate
LY400115 100 µg

PLOD1 (NM_000302) Human Over-expression Lysate

Sign In for Pricing
View Details
NSF Antibody
KC-35413-01 50 μL

NSF Antibody

Sign In for Pricing
View Details
NSF Antibody
KC-35413-02 100 µL

NSF Antibody

Sign In for Pricing
View Details
NSF Antibody
KC-35413-03 1 mL

NSF Antibody

Sign In for Pricing
View Details