Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mammuthus primigenius ATP synthase subunit a (MT-ATP6)

This Recombinant Mammuthus primigenius ATP synthase subunit a (MT-ATP6) spans the amino acid sequence from region 1-222.

Product Specifications

Product Name Alternative

ATP synthase subunit a, F-ATPase protein 6

UniProt

Q38PR7

Expression Region

1-222

Origin

Mammuthus primigenius (Siberian woolly mammoth)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNEELSAFFDVPVGTMMLAIAFPAILLPTPNRLITNRWITIQQWLVKLIMKQLLSIHNTK GLSWSLMLITLTLFIGLTNLLGLLPYSFAPTAQLTVNLSMAIPLWTGTVILGFRYKTKIS LAHLLPQGTPTFLIPMIIIIETISLLIRPVTLAVRLTANITAGHLLIHLTGTAALTLLSI HSMTITVTFITVVVLTILELAVALIQAYVFALLISLYLHESA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rtl3 Mouse Gene Knockout Kit (CRISPR)
KN519666 1 Kit

Rtl3 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CD16 (FCGR3A) Human Recombinant Protein
TP721246 25 µg

CD16 (FCGR3A) Human Recombinant Protein

Sign In for Pricing
View Details
MIR6853 Human qPCR Primer Pair (MI0022699)
HP301453 200 Reactions

MIR6853 Human qPCR Primer Pair (MI0022699)

Sign In for Pricing
View Details
Mouse Nucleolin (NCL) ELISA Kit
RDR-NCL-Mu-01 96 Tests

Mouse Nucleolin (NCL) ELISA Kit

Sign In for Pricing
View Details
Mouse Nucleolin (NCL) ELISA Kit
RDR-NCL-Mu-02 48 Tests

Mouse Nucleolin (NCL) ELISA Kit

Sign In for Pricing
View Details
Human Perilipin 3 (PLIN3) ELISA Kit
RD-PLIN3-Hu-01 96 Tests

Human Perilipin 3 (PLIN3) ELISA Kit

Sign In for Pricing
View Details