Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Loxodonta africana ATP synthase subunit a (MT-ATP6)

This Recombinant Loxodonta africana ATP synthase subunit a (MT-ATP6) spans the amino acid sequence from region 1-222.

Product Specifications

Product Name Alternative

ATP synthase subunit a, F-ATPase protein 6

UniProt

Q9TA24

Expression Region

1-222

Origin

Loxodonta africana (African elephant)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNEELSTFFYVPVGTMMLAIAFPAILLPTPNRLITNRWITIQQWLIQLIMKQLLSIHNTK GLSWSLMLITLTLFIGLTNLLGLLPYSFAPTTQLTVNLSMAIPLWTGTVVPGFRYKTKIS LAHLLPQGTPMFLIPMIIIIETISLLIRPVTLAVRLTANITAGHSLIHLTGTATLTLSSI HSMTITVTFVTVILLTILELAVALIQAYVFALLISLYLHENA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD3e (RIV9), CF680R conjugate, 0.1mg/mL
BNC810322-100 1x 100 µL

CD3e (RIV9), CF680R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (CRIS-7), CF647 conjugate, 0.1mg/mL
BNC471050-500 1x 500 µL

CD3e (CRIS-7), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MAGE A1 (MA454), CF568 conjugate, 0.1mg/mL
BNC680008-500 1x 500 µL

MAGE A1 (MA454), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 Standard (DF1485), CF488A conjugate, 0.1mg/mL
BNC881037-500 1x 500 µL

CD44 Standard (DF1485), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD74 (BU45), CF405S conjugate, 0.1mg/mL
BNC040189-100 1x 100 µL

CD74 (BU45), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MART-1 / Melan-A (M2-7C10), CF568 conjugate, 0.1mg/mL
BNC680009-100 1x 100 µL

MART-1 / Melan-A (M2-7C10), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details