Recombinant Chlorobium limicola Cobalt transport protein CbiM (cbiM)
This Recombinant Chlorobium limicola Cobalt transport protein CbiM (cbiM) spans the amino acid sequence from region 32-254.
Product Specifications
Product Name Alternative
Cobalt transport protein CbiM, Energy-coupling factor transporter probable substrate-capture protein CbiM, ECF transporter S component CbiM
UniProt
B3EC54
Expression Region
32-254
Origin
Chlorobium limicola (strain DSM 245 / NBRC 103803)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MHIMEGFLPPSWSLFWWVLTLPFLVVGFRSLRKIVDANPRMKLLLAMAGAFAFVLSSLKI PSVTGSCSHPTGVGLGAVLFGPSVMSVLGVIVLLFQALLLAHGGLTTLGANAFSMAIAGP FVSYGIYRLMVMSKAPEWLAVFLAAAIGDLMTYVVTSLQLALAFPSVTGGIAASLGKFMT IFALTQVPLAISEGILTVMVFSAIREYASELFPASGTLAKEGV
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC680225-500 1x 500 µL
Major Vault Protein (MVP) (1032), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880266-100 1x 100 µL
Human IgG Immunoglobulin (IG266), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC700745-100 1x 100 µL
CD45 / LCA (2B11 + PD7/26), CF770 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC401003-100 1x 100 µL
Mucin 5AC (MUC5AC) (58M1), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details