Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Clostridium phytofermentans Cobalt transport protein CbiM (cbiM)

This Recombinant Clostridium phytofermentans Cobalt transport protein CbiM (cbiM) spans the amino acid sequence from region 27-250.

Product Specifications

Product Name Alternative

Cobalt transport protein CbiM, Energy-coupling factor transporter probable substrate-capture protein CbiM, ECF transporter S component CbiM

UniProt

A9KP98

Expression Region

27-250

Origin

Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

AMHIMEGYLPPKYCITWGILSIPFLVAGYFSIKKTVSKQHRSITMLAMAGAFVFVLSSLK IPSVTGSCSHMTGTGLGAILFGPSAVSILGIIVLIFQAILLAHGGLTTLGANTFSMAIAG PFVSFGIYKLCQKLKVNKLSGIFLAAFVGDLFTYCVTSIQLALAYPSSNGGVGASALKFL AVFAPTQVPLAIIEGILTVVIMIGLETYAKAELNDLGLVNGGIN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD11a (Cris-3), CF640R conjugate, 0.1mg/mL
BNC400151-500 1x 500 µL

CD11a (Cris-3), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Histone H1 (AE-4), CF640R conjugate, 0.1mg/mL
BNC400096-500 1x 500 µL

Histone H1 (AE-4), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P53 (PAb122), CF740 conjugate, 0.1mg/mL
BNC740338-500 1x 500 µL

P53 (PAb122), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD63 (MX-49.129.5), CF555 conjugate, 0.1mg/mL
BNC550525-100 1x 100 µL

CD63 (MX-49.129.5), CF555 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD95 (B-R18), CF740 conjugate, 0.1mg/mL
BNC740305-100 1x 100 µL

CD95 (B-R18), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e (RIV9), CF740 conjugate, 0.1mg/mL
BNC740322-500 1x 500 µL

CD3e (RIV9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details