Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Clostridium difficile Cobalt transport protein CbiM (cbiM)

This Recombinant Clostridium difficile Cobalt transport protein CbiM (cbiM) spans the amino acid sequence from region 26-250.

Product Specifications

Product Name Alternative

Cobalt transport protein CbiM, Energy-coupling factor transporter probable substrate-capture protein CbiM, ECF transporter S component CbiM

UniProt

C9YID6

Expression Region

26-250

Origin

Clostridium difficile (strain R20291)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MHIMEGYLPVKWSIAWGVIFIPFFLVGLKSIGKIVKQDPKKKVLLALCGAFVFVLSALKI PSVTGSCSHPTGVGLGAIMFGPSVMFVLGTIVLIFQALLLAHGGITTLGANAFSMAIIGP IISFLIFKALKKKDGNNAMPVFLAAAIGDLATYTVTSIQLALAFPDPSGGVMASAIKFLG IFFMTQIPIAIAEGILTVIVYNLITENGEKSILENNDKGVKANEC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-RSK4 (Ser232) Rabbit mAb Antibody
orb3015892 100 µL

Phospho-RSK4 (Ser232) Rabbit mAb Antibody

Sign In for Pricing
View Details
Human IgM mu chain Antibody Fluorescein Conjugated
TA397234 20 mg

Human IgM mu chain Antibody Fluorescein Conjugated

Sign In for Pricing
View Details
RNU2-1 ORF Vector (Human) (pORF)
40371011 1.0 µg DNA

RNU2-1 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details
Recombinant Xenopus tropicalis TM2 domain-containing protein 2 (tm2d2)
orb2930672-01 20 µg

Recombinant Xenopus tropicalis TM2 domain-containing protein 2 (tm2d2)

Sign In for Pricing
View Details
Recombinant Xenopus tropicalis TM2 domain-containing protein 2 (tm2d2)
orb2930672-02 100 µg

Recombinant Xenopus tropicalis TM2 domain-containing protein 2 (tm2d2)

Sign In for Pricing
View Details
PTPN13 Antibody Blocking peptide
orb1445235 500 µg

PTPN13 Antibody Blocking peptide

Sign In for Pricing
View Details