Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis UPF0700 transmembrane protein yoaK (yoaK)

This Recombinant Bacillus subtilis UPF0700 transmembrane protein yoaK (yoaK) spans the amino acid sequence from region 1-225.

Product Specifications

Product Name Alternative

UPF0700 transmembrane protein yoaK

UniProt

O34343

Expression Region

1-225

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MTAAAYRNTLLSLLCLTAGIVDVIGYLSLGHVFTANMTGNIVLLGLAIGKSIQVTVFNSL TALIGFICGVIIATLMVGKAENTLWPSAVTKALALEAFILFVFACLSFYRAFVPVHILII LMSISMGIQTTAAKKLGIAGISSTVLTGTLASLLEDISGRLFFKKQKKTFLRDTVLRALA IILYCVGAIIVALAEPDFYHFIIWVPIVLIFGIMMTAKLKLSGEK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD74 (BU45), CF640R conjugate, 0.1mg/mL
BNC400189-500 1x 500 µL

CD74 (BU45), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Major Vault Protein (MVP) (1032), CF647 conjugate, 0.1mg/mL
BNC470225-100 1x 100 µL

Major Vault Protein (MVP) (1032), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD104 (UM-A9), CF740 conjugate, 0.1mg/mL
BNC740449-100 1x 100 µL

CD104 (UM-A9), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RO (UCHL-1), CF647 conjugate, 0.1mg/mL
BNC470003-500 1x 500 µL

CD45RO (UCHL-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Prostate Specific Acid Phosphatase (PSAP) (PASE/4LJ), CF405S conjugate, 0.1mg/mL
BNC041473-100 1x 100 µL

Prostate Specific Acid Phosphatase (PSAP) (PASE/4LJ), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Glypican-3 (GPC3/863 + 1G12), CF594 conjugate, 0.1mg/mL
BNC940864-100 1x 100 µL

Glypican-3 (GPC3/863 + 1G12), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details