Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Helicobacter acinonychis ATP synthase subunit a (atpB)

This Recombinant Helicobacter acinonychis ATP synthase subunit a (atpB) spans the amino acid sequence from region 1-226.

Product Specifications

Product Name Alternative

ATP synthase subunit a, ATP synthase F0 sector subunit a, F-ATPase subunit 6

UniProt

Q17WM4

Expression Region

1-226

Origin

Helicobacter acinonychis (strain Sheeba)

Field of Research

Immunology & Inflammation; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEHRVFTVANFFSSNHDFITGFFVVLTAVLMFLISLGASRKMQMVPMGLQNVYESIISAI LSVAKDIIGEELARKYFPLAGTIALYVFFSNMIGIIPSFESPTASWSFTLVLALIVFFYY HFEGIRVQGFFKYFAHFAGPVKWLAPFMFPIEIISHFSRIVSLSFRLFGNIKGDDMFLLI MLLLVPWVIPVAPFMVLFFMGILQAFVFMILTYVYLAGAVLTDEGH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Von Willebrand Factor (VWF) Human Gene Knockout Kit (CRISPR)
KN218497LP 1 Kit

Von Willebrand Factor (VWF) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TP53TG5 Antibody
KC-33617-01 50 μL

TP53TG5 Antibody

Sign In for Pricing
View Details
TP53TG5 Antibody
KC-33617-02 100 µL

TP53TG5 Antibody

Sign In for Pricing
View Details
TP53TG5 Antibody
KC-33617-03 1 mL

TP53TG5 Antibody

Sign In for Pricing
View Details
Nizatidine
TRC-N598500-50MG 50 mg

Nizatidine

Sign In for Pricing
View Details
4931406C07Rik Mouse Gene Knockout Kit (CRISPR)
KN500413 1 Kit

4931406C07Rik Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details